Lineage for d1dar_1 (1dar 283-400)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60076Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 60087Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 60088Family b.43.3.1: Elongation factors [50448] (4 proteins)
  6. 60095Protein Elongation factor G (EF-G), domain II [50456] (1 species)
  7. 60096Species Thermus thermophilus [TaxId:274] [50457] (5 PDB entries)
  8. 60097Domain d1dar_1: 1dar 283-400 [25707]
    Other proteins in same PDB: d1dar_2, d1dar_3, d1dar_4

Details for d1dar_1

PDB Entry: 1dar (more details), 2.4 Å

PDB Description: elongation factor g in complex with gdp

SCOP Domain Sequences for d1dar_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dar_1 b.43.3.1 (283-400) Elongation factor G (EF-G), domain II {Thermus thermophilus}
pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy
nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvile

SCOP Domain Coordinates for d1dar_1:

Click to download the PDB-style file with coordinates for d1dar_1.
(The format of our PDB-style files is described here.)

Timeline for d1dar_1: