Class b: All beta proteins [48724] (144 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (2 families) |
Family b.43.3.1: Elongation factors [50448] (8 proteins) |
Protein Elongation factor eEF-1alpha, domain 2 [50454] (2 species) eukaryotic and archaeal homologue of EF-Tu |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50455] (4 PDB entries) |
Domain d1g7ca1: 1g7c A:241-334 [25706] Other proteins in same PDB: d1g7ca2, d1g7ca3, d1g7cb_ |
PDB Entry: 1g7c (more details), 2.05 Å
SCOP Domain Sequences for d1g7ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g7ca1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae)} dkplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqg vpgdnvgfnvknvsvkeirrgnvcgdakndppkg
Timeline for d1g7ca1: