Lineage for d1f60a1 (1f60 A:241-334)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543994Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544037Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1544038Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 1544066Protein Elongation factor eEF-1alpha, domain 2 [50454] (2 species)
    eukaryotic and archaeal homologue of EF-Tu
  7. 1544067Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50455] (6 PDB entries)
  8. 1544068Domain d1f60a1: 1f60 A:241-334 [25705]
    Other proteins in same PDB: d1f60a2, d1f60a3, d1f60b_

Details for d1f60a1

PDB Entry: 1f60 (more details), 1.67 Å

PDB Description: crystal structure of the yeast elongation factor complex eef1a:eef1ba
PDB Compounds: (A:) elongation factor eef1a

SCOPe Domain Sequences for d1f60a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f60a1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dkplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqg
vpgdnvgfnvknvsvkeirrgnvcgdakndppkg

SCOPe Domain Coordinates for d1f60a1:

Click to download the PDB-style file with coordinates for d1f60a1.
(The format of our PDB-style files is described here.)

Timeline for d1f60a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f60b_