SCOPe 2.06: Domain d4ln2a1: 4ln2 A:866-930

Lineage for d4ln2a1 (4ln2 A:866-930)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (90 PDB entries)

8. Domain d4ln2a1: 4ln2 A:866-930 [257046]
   Other proteins in same PDB: d4ln2a2
   automated match to d2o9sa_

Details for d4ln2a1

PDB Entry: 4ln2, 1 Å

PDB Description: The second SH3 domain from CAP/Ponsin in complex with proline rich peptide from Vinculin

PDB Compounds: (A:) Sorbin and SH3 domain-containing protein 1

SCOPe Domain Sequences for d4ln2a1:

Sequence; same for both SEQRES and ATOM records:

>d4ln2a1 b.34.2.0 (A:866-930) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vleygeaiakfnfngdtqvemsfrkgeritllrqvdenwyegripgtsrqgifpityvdv
ikrpl

Timeline for d4ln2a1:

• d4ln2a1 first appeared in SCOPe 2.04, called d4ln2a_
  
• d4ln2a1 was called d4ln2a_ in SCOPe 2.05
  
• d4ln2a1 appears in SCOPe 2.07
  
• d4ln2a1 appears in the current release, SCOPe 2.08