Lineage for d4lmsb_ (4lms B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2689048Protein automated matches [190531] (23 species)
    not a true protein
  7. 2689052Species Chroomonas sp. [TaxId:3029] [257042] (1 PDB entry)
  8. 2689053Domain d4lmsb_: 4lms B: [257043]
    Other proteins in same PDB: d4lmsa_, d4lmsc_
    automated match to d1xg0d_
    complexed with cyc, dbv, m1v, p6g

Details for d4lmsb_

PDB Entry: 4lms (more details), 1.35 Å

PDB Description: light harvesting complex pc645 from the cryptophyte chroomonas sp. ccmp270
PDB Compounds: (B:) cryptophyte phycocyanin (beta chain)

SCOPe Domain Sequences for d4lmsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lmsb_ a.1.1.3 (B:) automated matches {Chroomonas sp. [TaxId: 3029]}
kaayvggadlqalkkfvsegnkrldavnaivsnascivsdavsgmicenpalispsgncy
tnrrmaaclrdaeiilryvsysllsgdssvledrclgglketyaslgvpaagnaravgim
katcvafinntsnqkklstpagdcsalasecagyfdkvtsal

SCOPe Domain Coordinates for d4lmsb_:

Click to download the PDB-style file with coordinates for d4lmsb_.
(The format of our PDB-style files is described here.)

Timeline for d4lmsb_: