Lineage for d1d2eb1 (1d2e B:251-348)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 464636Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 464647Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 464648Family b.43.3.1: Elongation factors [50448] (8 proteins)
  6. 464675Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 464676Species Cow (Bos taurus), mitochondrial [TaxId:9913] [50453] (1 PDB entry)
  8. 464678Domain d1d2eb1: 1d2e B:251-348 [25702]
    Other proteins in same PDB: d1d2ea2, d1d2ea3, d1d2eb2, d1d2eb3, d1d2ec2, d1d2ec3, d1d2ed2, d1d2ed3

Details for d1d2eb1

PDB Entry: 1d2e (more details), 1.94 Å

PDB Description: crystal structure of mitochondrial ef-tu in complex with gdp

SCOP Domain Sequences for d1d2eb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2eb1 b.43.3.1 (B:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial}
trdlekpfllpvesvysipgrgtvvtgtlergilkkgdeceflghsknirtvvtgiemfh
ksldraeagdnlgalvrglkredlrrglvmakpgsiqp

SCOP Domain Coordinates for d1d2eb1:

Click to download the PDB-style file with coordinates for d1d2eb1.
(The format of our PDB-style files is described here.)

Timeline for d1d2eb1: