Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
Protein automated matches [190158] (31 species) not a true protein |
Species Pseudomonas sp. [TaxId:165468] [256995] (2 PDB entries) |
Domain d4la4a_: 4la4 A: [256996] automated match to d1ydga_ |
PDB Entry: 4la4 (more details), 2.07 Å
SCOPe Domain Sequences for d4la4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4la4a_ c.23.5.0 (A:) automated matches {Pseudomonas sp. [TaxId: 165468]} ptkiqivfyssyghiykmaeaiaagarevgdvevtllqvpelmpeevqvksgikgyraaf gsipyatpevlaeadaiifgtptrfgnmcsqmrnfldqtgglwmsggligkvgsvftsta sqhggqettitsfhttllhhgmvivgvpysepgltnmteisggtpygastlagadgsrqp senelqiarfqgkhvatiakrlannk
Timeline for d4la4a_: