Class b: All beta proteins [48724] (149 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (3 families) |
Family b.43.3.1: Elongation factors [50448] (9 proteins) |
Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species) N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology |
Species Thermus thermophilus [TaxId:274] [50452] (3 PDB entries) |
Domain d1aipb1: 1aip B:213-312 [25698] Other proteins in same PDB: d1aipa2, d1aipa3, d1aipb2, d1aipb3, d1aipc1, d1aipc2, d1aipd1, d1aipd2, d1aipe2, d1aipe3, d1aipf2, d1aipf3, d1aipg1, d1aipg2, d1aiph1, d1aiph2 |
PDB Entry: 1aip (more details), 3 Å
SCOP Domain Sequences for d1aipb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aipb1 b.43.3.1 (B:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus} pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrrtvvtgvem hrktlqegiagdnvgvllrgvsreevergqvlakpgsitp
Timeline for d1aipb1: