Lineage for d1aipb1 (1aip B:213-312)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14602Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 14691Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 14692Family b.43.3.1: Elongation factors [50448] (4 proteins)
  6. 14704Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
  7. 14728Species Thermus thermophilus [TaxId:274] [50452] (2 PDB entries)
  8. 14731Domain d1aipb1: 1aip B:213-312 [25698]
    Other proteins in same PDB: d1aipa2, d1aipa3, d1aipb2, d1aipb3, d1aipc_, d1aipd_, d1aipe2, d1aipe3, d1aipf2, d1aipf3, d1aipg_, d1aiph_

Details for d1aipb1

PDB Entry: 1aip (more details), 3 Å

PDB Description: ef-tu ef-ts complex from thermus thermophilus

SCOP Domain Sequences for d1aipb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aipb1 b.43.3.1 (B:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrrtvvtgvem
hrktlqegiagdnvgvllrgvsreevergqvlakpgsitp

SCOP Domain Coordinates for d1aipb1:

Click to download the PDB-style file with coordinates for d1aipb1.
(The format of our PDB-style files is described here.)

Timeline for d1aipb1: