Lineage for d1exma1 (1exm A:213-312)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14602Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 14691Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 14692Family b.43.3.1: Elongation factors [50448] (4 proteins)
  6. 14704Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
  7. 14728Species Thermus thermophilus [TaxId:274] [50452] (2 PDB entries)
  8. 14729Domain d1exma1: 1exm A:213-312 [25696]
    Other proteins in same PDB: d1exma2, d1exma3

Details for d1exma1

PDB Entry: 1exm (more details), 1.7 Å

PDB Description: crystal structure of thermus thermophilus elongation factor tu (ef-tu) in complex with the gtp analogue gppnhp.

SCOP Domain Sequences for d1exma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exma1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvgvllrgvsreevergqvlakpgsitp

SCOP Domain Coordinates for d1exma1:

Click to download the PDB-style file with coordinates for d1exma1.
(The format of our PDB-style files is described here.)

Timeline for d1exma1: