Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.1: Elongation factors [50448] (11 proteins) |
Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species) N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology |
Species Thermus thermophilus [TaxId:274] [50452] (4 PDB entries) |
Domain d1exma1: 1exm A:213-312 [25696] Other proteins in same PDB: d1exma2, d1exma3 protein/RNA complex; complexed with gnp, mg |
PDB Entry: 1exm (more details), 1.7 Å
SCOPe Domain Sequences for d1exma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1exma1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem hrktlqegiagdnvgvllrgvsreevergqvlakpgsitp
Timeline for d1exma1: