Lineage for d1tuic1 (1tui C:213-312)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60076Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 60087Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 60088Family b.43.3.1: Elongation factors [50448] (4 proteins)
  6. 60102Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
  7. 60117Species Thermus aquaticus [TaxId:271] [50451] (4 PDB entries)
  8. 60125Domain d1tuic1: 1tui C:213-312 [25695]
    Other proteins in same PDB: d1tuia2, d1tuia3, d1tuib2, d1tuib3, d1tuic2, d1tuic3

Details for d1tuic1

PDB Entry: 1tui (more details), 2.7 Å

PDB Description: intact elongation factor tu in complex with gdp
PDB Compounds: (C:)

SCOP Domain Sequences for d1tuic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tuic1 b.43.3.1 (C:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus aquaticus}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvglllrgvsreevergqvlakpgsitp

SCOP Domain Coordinates for d1tuic1:

Click to download the PDB-style file with coordinates for d1tuic1.
(The format of our PDB-style files is described here.)

Timeline for d1tuic1: