Lineage for d4kzna_ (4kzn A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2584898Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2584899Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2584900Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 2584912Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 2584915Species Human (Homo sapiens) [TaxId:9606] [57506] (21 PDB entries)
    Uniprot P15692 40-133
  8. 2584928Domain d4kzna_: 4kzn A: [256948]
    automated match to d2vpfa_
    complexed with bma, fuc, man, nag, pge, so4

Details for d4kzna_

PDB Entry: 4kzn (more details), 1.71 Å

PDB Description: crystal structure of human vegf-a receptor binding domain
PDB Compounds: (A:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d4kzna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kzna_ g.17.1.1 (A:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpk

SCOPe Domain Coordinates for d4kzna_:

Click to download the PDB-style file with coordinates for d4kzna_.
(The format of our PDB-style files is described here.)

Timeline for d4kzna_: