Lineage for d1tuib1 (1tui B:213-312)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 560964Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 560975Superfamily b.43.3: Translation proteins [50447] (3 families) (S)
  5. 560976Family b.43.3.1: Elongation factors [50448] (9 proteins)
  6. 561023Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 561040Species Thermus aquaticus [TaxId:271] [50451] (4 PDB entries)
  8. 561047Domain d1tuib1: 1tui B:213-312 [25694]
    Other proteins in same PDB: d1tuia2, d1tuia3, d1tuib2, d1tuib3, d1tuic2, d1tuic3

Details for d1tuib1

PDB Entry: 1tui (more details), 2.7 Å

PDB Description: intact elongation factor tu in complex with gdp

SCOP Domain Sequences for d1tuib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tuib1 b.43.3.1 (B:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus aquaticus}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvglllrgvsreevergqvlakpgsitp

SCOP Domain Coordinates for d1tuib1:

Click to download the PDB-style file with coordinates for d1tuib1.
(The format of our PDB-style files is described here.)

Timeline for d1tuib1: