Lineage for d1tuia1 (1tui A:213-313)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14602Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 14691Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 14692Family b.43.3.1: Elongation factors [50448] (4 proteins)
  6. 14704Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
  7. 14719Species Thermus aquaticus [TaxId:271] [50451] (4 PDB entries)
  8. 14725Domain d1tuia1: 1tui A:213-313 [25693]
    Other proteins in same PDB: d1tuia2, d1tuia3, d1tuib2, d1tuib3, d1tuic2, d1tuic3

Details for d1tuia1

PDB Entry: 1tui (more details), 2.7 Å

PDB Description: intact elongation factor tu in complex with gdp

SCOP Domain Sequences for d1tuia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tuia1 b.43.3.1 (A:213-313) Elongation factor Tu (EF-Tu), domain 2 {Thermus aquaticus}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvglllrgvsreevergqvlakpgsitph

SCOP Domain Coordinates for d1tuia1:

Click to download the PDB-style file with coordinates for d1tuia1.
(The format of our PDB-style files is described here.)

Timeline for d1tuia1: