Lineage for d1tuia1 (1tui A:213-313)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2792985Family b.43.3.1: Elongation factors [50448] (11 proteins)
  6. 2793069Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 2793093Species Thermus aquaticus [TaxId:271] [50451] (4 PDB entries)
  8. 2793098Domain d1tuia1: 1tui A:213-313 [25693]
    Other proteins in same PDB: d1tuia2, d1tuia3, d1tuib2, d1tuib3, d1tuic2, d1tuic3
    complexed with gdp, mg

Details for d1tuia1

PDB Entry: 1tui (more details), 2.7 Å

PDB Description: intact elongation factor tu in complex with gdp
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d1tuia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tuia1 b.43.3.1 (A:213-313) Elongation factor Tu (EF-Tu), domain 2 {Thermus aquaticus [TaxId: 271]}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvglllrgvsreevergqvlakpgsitph

SCOPe Domain Coordinates for d1tuia1:

Click to download the PDB-style file with coordinates for d1tuia1.
(The format of our PDB-style files is described here.)

Timeline for d1tuia1: