Lineage for d4kr8c_ (4kr8 C:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575768Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2575889Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2575890Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. 2575961Protein automated matches [190289] (6 species)
    not a true protein
  7. 2576003Species Salmonella enterica [TaxId:527001] [193694] (2 PDB entries)
  8. 2576009Domain d4kr8c_: 4kr8 C: [256894]
    automated match to d3nsga_
    complexed with dm1

Details for d4kr8c_

PDB Entry: 4kr8 (more details), 3.1 Å

PDB Description: salmonella typhi ompf complex with daunomycin
PDB Compounds: (C:) Outer membrane protein F

SCOPe Domain Sequences for d4kr8c_:

Sequence, based on SEQRES records: (download)

>d4kr8c_ f.4.3.1 (C:) automated matches {Salmonella enterica [TaxId: 527001]}
meiynkdgnkldlygkavgrhvwtttgdsknadqtyaqigfkgetqintdltgfgqweyr
tkadraegeqqnsnlvrlafaglkyaevgsidygrnygivydvesytdmapyfsgetwgg
aytdnymtsragglltyrnsdffglvdglsfgiqyqgknqdnhsinsqngdgvgytmaye
fdgfgvtaaysnskrtndqqdrdgngdraesravgakydannvylaavyaetrnmsiven
tvtdtvemanktqnlevvaqyqfdfglrpaisyvqskgkqlngaggsadlakyiqagaty
yfnknmnvwvdyrfnlldendysssyvgtddqaavgityqf

Sequence, based on observed residues (ATOM records): (download)

>d4kr8c_ f.4.3.1 (C:) automated matches {Salmonella enterica [TaxId: 527001]}
meiynkdgnkldlygkavgrhvwtttgdsknadqtyaqigfkgetqintdltgfgqweyr
tkadraegeqqnsnlvrlafaglkyaevgsidygrnygivydvesytdmapyfsgetwgg
aytdnymtsragglltyrnsdffglvdglsfgiqyqgknqdnhsinsqngdgvgytmaye
fdgfgvtaaysnskrtndqqdrdgngdraesravgakydannvylaavyaetrnmsiven
tvtdtvemanktqnlevvaqyqfdfglrpaisyvqskgkqlnaggsadlakyiqagatyy
fnknmnvwvdyrfnlldendysssyvgtddqaavgityqf

SCOPe Domain Coordinates for d4kr8c_:

Click to download the PDB-style file with coordinates for d4kr8c_.
(The format of our PDB-style files is described here.)

Timeline for d4kr8c_: