Lineage for d1eft_1 (1eft 213-312)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60076Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 60087Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 60088Family b.43.3.1: Elongation factors [50448] (4 proteins)
  6. 60102Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
  7. 60117Species Thermus aquaticus [TaxId:271] [50451] (4 PDB entries)
  8. 60119Domain d1eft_1: 1eft 213-312 [25688]
    Other proteins in same PDB: d1eft_2, d1eft_3

Details for d1eft_1

PDB Entry: 1eft (more details), 2.5 Å

PDB Description: the crystal structure of elongation factor ef-tu from thermus aquaticus in the gtp conformation

SCOP Domain Sequences for d1eft_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eft_1 b.43.3.1 (213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus aquaticus}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvglllrgvsreevergqvlakpgsitp

SCOP Domain Coordinates for d1eft_1:

Click to download the PDB-style file with coordinates for d1eft_1.
(The format of our PDB-style files is described here.)

Timeline for d1eft_1: