Class b: All beta proteins [48724] (174 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (6 families) |
Family b.43.3.1: Elongation factors [50448] (10 proteins) |
Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species) N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology |
Species Escherichia coli [TaxId:562] [50450] (7 PDB entries) Uniprot P02990 |
Domain d1d8tb1: 1d8t B:205-296 [25687] Other proteins in same PDB: d1d8ta2, d1d8ta3, d1d8tb2, d1d8tb3 complexed with ace, gdp, gea, mg |
PDB Entry: 1d8t (more details), 2.35 Å
SCOP Domain Sequences for d1d8tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d8tb1 b.43.3.1 (B:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl ldegragenvgvllrgikreeiergqvlakpg
Timeline for d1d8tb1: