SCOPe 2.08: Domain d4k6ra2: 4k6r A:264-474

Lineage for d4k6ra2 (4k6r A:264-474)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (36 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [224870] (7 PDB entries)

8. Domain d4k6ra2: 4k6r A:264-474 [256842]
   Other proteins in same PDB: d4k6ra1
   automated match to d3d8va2
   complexed with atp, co, gn1, mg

Details for d4k6ra2

PDB Entry: 4k6r, 1.98 Å

PDB Description: crystal structure of glmu in complex with atp

PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d4k6ra2:

Sequence; same for both SEQRES and ATOM records:

>d4k6ra2 b.81.1.0 (A:264-474) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
vtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvvgpdttltdvavgdgasvvr
thgssssigdgaavgpftylrpgtalgadgklgafvevknstigtgtkvphltyvgdadi
geysnigassvfvnydgtskrrttvgshvrtgsdtmfvapvtigdgaytgagtvvredvp
pgalavsagpqrnienwvqrkrpgspaaqas

Timeline for d4k6ra2:

• d4k6ra2 first appeared in SCOPe 2.04
  
• d4k6ra2 appears in SCOPe 2.07