Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (56 species) not a true protein |
Species Bradyrhizobium elkanii [TaxId:29448] [256834] (1 PDB entry) |
Domain d4k2ab_: 4k2a B: [256835] automated match to d3sk0a_ complexed with act, cl |
PDB Entry: 4k2a (more details), 2.2 Å
SCOPe Domain Sequences for d4k2ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k2ab_ c.69.1.0 (B:) automated matches {Bradyrhizobium elkanii [TaxId: 29448]} dislhhravlgstmayretgrsdaphvlflhgnptssyiwrnimplvapvghciapdlig ygqsgkpdisyrffdqadyldalidelgiasaylvaqdwgtalafhlaarrpqlvrglaf mefirpmrdwsdfhqhdaaretfrkfrtpgvgeamildnnafvervlpgsilrtlseeem aayrapfatresrmptlmlprelpiagepadvtqaltaahaalaastypkllfvgspgal vspafaaefaktlkhcaviqlgagghylqedhpeaigrsvagwiagieaas
Timeline for d4k2ab_: