SCOPe 2.06: Domain d4jyqb_: 4jyq B:

Lineage for d4jyqb_ (4jyq B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (31 PDB entries)

8. Domain d4jyqb_: 4jyq B: [256824]
   automated match to d1ew6a_
   complexed with cmo, hem, so4

Details for d4jyqb_

PDB Entry: 4jyq, 1.8 Å

PDB Description: dhp-co crystal structure

PDB Compounds: (B:) Dehaloperoxidase A

SCOPe Domain Sequences for d4jyqb_:

Sequence; same for both SEQRES and ATOM records:

>d4jyqb_ a.1.1.2 (B:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d4jyqb_:

• d4jyqb_ first appeared in SCOPe 2.04
  
• d4jyqb_ appears in SCOPe 2.05
  
• d4jyqb_ appears in SCOPe 2.07
  
• d4jyqb_ appears in the current release, SCOPe 2.08