Lineage for d1efca1 (1efc A:205-296)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14602Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 14691Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 14692Family b.43.3.1: Elongation factors [50448] (4 proteins)
  6. 14704Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
  7. 14710Species Escherichia coli [TaxId:562] [50450] (4 PDB entries)
  8. 14711Domain d1efca1: 1efc A:205-296 [25680]
    Other proteins in same PDB: d1efca2, d1efca3, d1efcb2, d1efcb3

Details for d1efca1

PDB Entry: 1efc (more details), 2.05 Å

PDB Description: intact elongation factor from e.coli

SCOP Domain Sequences for d1efca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efca1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOP Domain Coordinates for d1efca1:

Click to download the PDB-style file with coordinates for d1efca1.
(The format of our PDB-style files is described here.)

Timeline for d1efca1: