Lineage for d4jkxa_ (4jkx A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999974Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2999975Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2999976Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 3000147Protein automated matches [190420] (9 species)
    not a true protein
  7. 3000177Species European mistletoe (Viscum album) [TaxId:3972] [188629] (7 PDB entries)
  8. 3000180Domain d4jkxa_: 4jkx A: [256796]
    Other proteins in same PDB: d4jkxb1, d4jkxb2
    automated match to d1puma_
    complexed with azi, cl, dio, edo, gol, h35, nag, so4

Details for d4jkxa_

PDB Entry: 4jkx (more details), 2.35 Å

PDB Description: crystal structure mistletoe lectin i from viscum album in complex with kinetin at 2.35 a resolution.
PDB Compounds: (A:) Beta-galactoside-specific lectin 1 A chain

SCOPe Domain Sequences for d4jkxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jkxa_ d.165.1.1 (A:) automated matches {European mistletoe (Viscum album) [TaxId: 3972]}
yerlrlrvthqttgaeyfsfitllrdyvssgsfsnqipllrqstipvsegqrfvlveltn
aggdsitaaidvtnlyvvayqagdqsyflkdapagaetqdftgttrsslpfngsypdler
yaghrdqiplgidqliqsvtalrfpggstrtqarsililiqmiseaarfnpilwrarqyi
nsgasflpdvymleletswgqqstqvqhstdgvfnnpirlalapanivtltnvrdviasl
aimlfvcge

SCOPe Domain Coordinates for d4jkxa_:

Click to download the PDB-style file with coordinates for d4jkxa_.
(The format of our PDB-style files is described here.)

Timeline for d4jkxa_: