Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) |
Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
Protein automated matches [190420] (9 species) not a true protein |
Species European mistletoe (Viscum album) [TaxId:3972] [188629] (7 PDB entries) |
Domain d4jkxa_: 4jkx A: [256796] Other proteins in same PDB: d4jkxb1, d4jkxb2 automated match to d1puma_ complexed with azi, cl, dio, edo, gol, h35, nag, so4 |
PDB Entry: 4jkx (more details), 2.35 Å
SCOPe Domain Sequences for d4jkxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jkxa_ d.165.1.1 (A:) automated matches {European mistletoe (Viscum album) [TaxId: 3972]} yerlrlrvthqttgaeyfsfitllrdyvssgsfsnqipllrqstipvsegqrfvlveltn aggdsitaaidvtnlyvvayqagdqsyflkdapagaetqdftgttrsslpfngsypdler yaghrdqiplgidqliqsvtalrfpggstrtqarsililiqmiseaarfnpilwrarqyi nsgasflpdvymleletswgqqstqvqhstdgvfnnpirlalapanivtltnvrdviasl aimlfvcge
Timeline for d4jkxa_: