Lineage for d1fuie1 (1fui E:356-591)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14602Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 14681Superfamily b.43.2: L-fucose isomerase, C-terminal domain [50443] (1 family) (S)
  5. 14682Family b.43.2.1: L-fucose isomerase, C-terminal domain [50444] (1 protein)
  6. 14683Protein L-fucose isomerase, C-terminal domain [50445] (1 species)
  7. 14684Species Escherichia coli [TaxId:562] [50446] (1 PDB entry)
  8. 14689Domain d1fuie1: 1fui E:356-591 [25678]
    Other proteins in same PDB: d1fuia2, d1fuib2, d1fuic2, d1fuid2, d1fuie2, d1fuif2

Details for d1fuie1

PDB Entry: 1fui (more details), 2.5 Å

PDB Description: l-fucose isomerase from escherichia coli

SCOP Domain Sequences for d1fuie1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fuie1 b.43.2.1 (E:356-591) L-fucose isomerase, C-terminal domain {Escherichia coli}
aqvfadvrtywspeaiervtghkldglaehgiihlinsgsaaldgsckqrdsegnptmkp
hweisqqeadaclaatewcpaiheyfrgggyssrflteggvpftmtrvniikglgpvlqi
aegwsvelpkdvhdilnkrtnstwpttwfaprltgkgpftdvysvmanwganhgvltigh
vgadfitlasmlripvcmhnveetkvyrpsawaahgmdiegqdyracqnygplykr

SCOP Domain Coordinates for d1fuie1:

Click to download the PDB-style file with coordinates for d1fuie1.
(The format of our PDB-style files is described here.)

Timeline for d1fuie1: