SCOPe 2.06: Domain d4d0na_: 4d0n A:

Lineage for d4d0na_ (4d0n A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (179 PDB entries)

8. Domain d4d0na_: 4d0n A: [256767]
   automated match to d4f38a_
   complexed with edo, gdp, so4

Details for d4d0na_

PDB Entry: 4d0n, 2.1 Å

PDB Description: akap13 (akap-lbc) rhogef domain in complex with rhoa

PDB Compounds: (A:) transforming protein rhoa

SCOPe Domain Sequences for d4d0na_:

Sequence; same for both SEQRES and ATOM records:

>d4d0na_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa

Timeline for d4d0na_:

• d4d0na_ first appeared in SCOPe 2.04
  
• d4d0na_ appears in SCOPe 2.05
  
• d4d0na_ appears in SCOPe 2.07
  
• d4d0na_ appears in the current release, SCOPe 2.08