Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (58 species) not a true protein |
Species Influenza A virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId:757360] [256744] (2 PDB entries) |
Domain d4cyva_: 4cyv A: [256745] Other proteins in same PDB: d4cyvb_, d4cyvd_, d4cyvf_ automated match to d4f23a1 complexed with edo, nag |
PDB Entry: 4cyv (more details), 2.3 Å
SCOPe Domain Sequences for d4cyva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cyva_ b.19.1.0 (A:) automated matches {Influenza A virus (a/mallard/sweden/51/2002 (h10n2)) [TaxId: 757360]} dkiclghhavangtivktltneqeevtnatetvestsldrlcmkgrshkdlgnchpigml igtpacdlhltgtwdtlierenaiaycypgatvneealrqkimesggiskistgftygss insagttkacmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhpss tqekndlygtqslsisvgsstyqsnfvpvvgarpqvngqsgridfhwtlvqpgdnitfsh nggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcpk yvnkkslmlatgmrnvpe
Timeline for d4cyva_: