Lineage for d4cxia_ (4cxi A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647422Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1647423Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1647603Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 1647604Protein automated matches [190710] (3 species)
    not a true protein
  7. 1647605Species Human (Homo sapiens) [TaxId:9606] [187857] (21 PDB entries)
  8. 1647634Domain d4cxia_: 4cxi A: [256732]
    automated match to d3ohua_

Details for d4cxia_

PDB Entry: 4cxi (more details), 2.35 Å

PDB Description: BTB domain of KEAP1
PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d4cxia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cxia_ d.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtfsytledhtkqafgimnelrlsqqlcdvtlqvkyqdapaaqfmahkvvlassspvfka
mftnglreqgmevvsiegihpkvmerliefaytasismgekcvlhvmngavmyqidsvvr
acadflvqql

SCOPe Domain Coordinates for d4cxia_:

Click to download the PDB-style file with coordinates for d4cxia_.
(The format of our PDB-style files is described here.)

Timeline for d4cxia_: