Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.0: automated matches [191460] (1 protein) not a true family |
Protein automated matches [190710] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187857] (21 PDB entries) |
Domain d4cxia_: 4cxi A: [256732] automated match to d3ohua_ |
PDB Entry: 4cxi (more details), 2.35 Å
SCOPe Domain Sequences for d4cxia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cxia_ d.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtfsytledhtkqafgimnelrlsqqlcdvtlqvkyqdapaaqfmahkvvlassspvfka mftnglreqgmevvsiegihpkvmerliefaytasismgekcvlhvmngavmyqidsvvr acadflvqql
Timeline for d4cxia_: