Class g: Small proteins [56992] (91 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.0: automated matches [227227] (1 protein) not a true family |
Protein automated matches [226968] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225423] (21 PDB entries) |
Domain d4cuea2: 4cue A:453-491 [256718] automated match to d1toza2 complexed with ca; mutant |
PDB Entry: 4cue (more details), 3 Å
SCOPe Domain Sequences for d4cuea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cuea2 g.3.11.0 (A:453-491) automated matches {Human (Homo sapiens) [TaxId: 9606]} vnecvsnpcqndavcldqigefqcicmpgyegvhcevnt
Timeline for d4cuea2: