Lineage for d1ddga1 (1ddg A:226-446)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1126671Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1126987Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 1126988Family b.43.4.1: NADPH-cytochrome p450 reductase FAD-binding domain-like [50438] (3 proteins)
    there is an alpha-helical subdomain inserted in this domain
  6. 1127004Protein Sulfite reductase flavoprotein [50441] (1 species)
  7. 1127005Species Escherichia coli [TaxId:562] [50442] (2 PDB entries)
  8. 1127006Domain d1ddga1: 1ddg A:226-446 [25671]
    Other proteins in same PDB: d1ddga2, d1ddgb2
    complexed with fad, so4

Details for d1ddga1

PDB Entry: 1ddg (more details), 2.01 Å

PDB Description: crystal structure of sir-fp60
PDB Compounds: (A:) sulfite reductase (nadph) flavoprotein alpha-component

SCOPe Domain Sequences for d1ddga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddga1 b.43.4.1 (A:226-446) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]}
ihtspyskdaplvaslsvnqkitgrnsekdvrhieidlgdsglryqpgdalgvwyqndpa
lvkelvellwlkgdepvtvegktlplnealqwhfeltvntanivenyatltrsetllplv
gdkaklqhyaattpivdmvrfspaqldaealinllrpltprlysiassqaevenevhvtv
gvvrydvegraraggassfladrveeegevrvfiehndnfr

SCOPe Domain Coordinates for d1ddga1:

Click to download the PDB-style file with coordinates for d1ddga1.
(The format of our PDB-style files is described here.)

Timeline for d1ddga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ddga2