Lineage for d4ct4b2 (4ct4 B:302-469)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849617Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1849618Protein automated matches [190123] (96 species)
    not a true protein
  7. 1849890Species Human (Homo sapiens) [TaxId:9606] [186862] (102 PDB entries)
  8. 1849996Domain d4ct4b2: 4ct4 B:302-469 [256696]
    automated match to d4brwa2
    protein/RNA complex; complexed with cl, mg

Details for d4ct4b2

PDB Entry: 4ct4 (more details), 2.3 Å

PDB Description: CNOT1 MIF4G domain - DDX6 complex
PDB Compounds: (B:) probable ATP-dependent RNA helicase ddx6

SCOPe Domain Sequences for d4ct4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ct4b2 c.37.1.0 (B:302-469) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eeltlkgvtqyyayvterqkvhclntlfsrlqinqsiifcnssqrvellakkisqlgysc
fyihakmrqehrnrvfhdfrnglcrnlvctdlftrgidiqavnvvinfdfpklaetylhr
igrsgrfghlglainlityddrfnlksieeqlgteikpipsnidksly

SCOPe Domain Coordinates for d4ct4b2:

Click to download the PDB-style file with coordinates for d4ct4b2.
(The format of our PDB-style files is described here.)

Timeline for d4ct4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ct4b1