Class b: All beta proteins [48724] (177 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins) coupled with a NADP-binding domain of alpha/beta class |
Protein Flavohemoglobin, central domain [50436] (2 species) contains additional globin domain |
Species Alcaligenes eutrophus [TaxId:106590] [50437] (1 PDB entry) |
Domain d1cqxa2: 1cqx A:151-261 [25667] Other proteins in same PDB: d1cqxa1, d1cqxa3, d1cqxb1, d1cqxb3 complexed with dgg, fad, hem, na |
PDB Entry: 1cqx (more details), 1.75 Å
SCOPe Domain Sequences for d1cqxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cqxa2 b.43.4.2 (A:151-261) Flavohemoglobin, central domain {Alcaligenes eutrophus [TaxId: 106590]} wkgwrtfvirekrpesdvitsfilepadggpvvnfepgqytsvaidvpalglqqirqysl sdmpngrtyrisvkregggpqppgyvsnllhdhvnvgdqvklaapygsfhi
Timeline for d1cqxa2: