Lineage for d1ep2b1 (1ep2 B:2-102)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167557Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 167645Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 167665Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (8 proteins)
  6. 167676Protein Dihydroorotate dehydrogenase B, PyrK subunit [50433] (1 species)
  7. 167677Species Lactococcus lactis, isozyme B [TaxId:1358] [50434] (3 PDB entries)
  8. 167680Domain d1ep2b1: 1ep2 B:2-102 [25666]
    Other proteins in same PDB: d1ep2a_, d1ep2b2

Details for d1ep2b1

PDB Entry: 1ep2 (more details), 2.4 Å

PDB Description: crystal structure of lactococcus lactis dihydroorotate dehydrogenase b complexed with orotate

SCOP Domain Sequences for d1ep2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ep2b1 b.43.4.2 (B:2-102) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B}
sqlqemmtvvsqrevaynifemvlkgtlvdemdlpgqflhlavpngamllrrpisisswd
kraktctilyrigdettgtyklsklesgakvdvmgplgngf

SCOP Domain Coordinates for d1ep2b1:

Click to download the PDB-style file with coordinates for d1ep2b1.
(The format of our PDB-style files is described here.)

Timeline for d1ep2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ep2b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ep2a_