Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.2: GAF domain-like [55781] (5 families) alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
Family d.110.2.1: GAF domain [55782] (8 proteins) |
Protein automated matches [227076] (1 species) not a true protein |
Species Deinococcus radiodurans [TaxId:1299] [226274] (1 PDB entry) |
Domain d4cqha2: 4cqh A:138-318 [256650] Other proteins in same PDB: d4cqha1, d4cqha3 automated match to d2o9ba1 complexed with lbv, na |
PDB Entry: 4cqh (more details), 1.14 Å
SCOPe Domain Sequences for d4cqha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cqha2 d.110.2.1 (A:138-318) automated matches {Deinococcus radiodurans [TaxId: 1299]} halrnamfalesapnlralaevatqtvrelsgfdrvmlykfapdatgeviaearregmqa ylghrfpasttpaqaralytrhllrltadtraaavpldpvlnpqtnaptplggavlrats pmhmqylrnmgvgsslsvsvvvggqlwglivchhqtpyvlppdlrttleylgrllslqvq r
Timeline for d4cqha2: