Lineage for d4cqha2 (4cqh A:138-318)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970135Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2970136Family d.110.2.1: GAF domain [55782] (8 proteins)
  6. 2970198Protein automated matches [227076] (1 species)
    not a true protein
  7. 2970199Species Deinococcus radiodurans [TaxId:1299] [226274] (1 PDB entry)
  8. 2970200Domain d4cqha2: 4cqh A:138-318 [256650]
    Other proteins in same PDB: d4cqha1, d4cqha3
    automated match to d2o9ba1
    complexed with lbv, na

Details for d4cqha2

PDB Entry: 4cqh (more details), 1.14 Å

PDB Description: Structure of Infrared Fluorescent Protein IFP2.0
PDB Compounds: (A:) Bacteriophytochrome

SCOPe Domain Sequences for d4cqha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cqha2 d.110.2.1 (A:138-318) automated matches {Deinococcus radiodurans [TaxId: 1299]}
halrnamfalesapnlralaevatqtvrelsgfdrvmlykfapdatgeviaearregmqa
ylghrfpasttpaqaralytrhllrltadtraaavpldpvlnpqtnaptplggavlrats
pmhmqylrnmgvgsslsvsvvvggqlwglivchhqtpyvlppdlrttleylgrllslqvq
r

SCOPe Domain Coordinates for d4cqha2:

Click to download the PDB-style file with coordinates for d4cqha2.
(The format of our PDB-style files is described here.)

Timeline for d4cqha2: