Lineage for d1ep1b1 (1ep1 B:2-102)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793458Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2793526Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 2793549Protein Dihydroorotate dehydrogenase B, PyrK subunit [50433] (1 species)
  7. 2793550Species Lactococcus lactis, isozyme B [TaxId:1358] [50434] (3 PDB entries)
  8. 2793552Domain d1ep1b1: 1ep1 B:2-102 [25665]
    Other proteins in same PDB: d1ep1a_, d1ep1b2
    complexed with fad, fes, fmn

Details for d1ep1b1

PDB Entry: 1ep1 (more details), 2.2 Å

PDB Description: crystal structure of lactococcus lactis dihydroorotate dehydrogenase b
PDB Compounds: (B:) dihydroorotate dehydrogenase b (pyrk subunit)

SCOPe Domain Sequences for d1ep1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ep1b1 b.43.4.2 (B:2-102) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]}
sqlqemmtvvsqrevaynifemvlkgtlvdemdlpgqflhlavpngamllrrpisisswd
kraktctilyrigdettgtyklsklesgakvdvmgplgngf

SCOPe Domain Coordinates for d1ep1b1:

Click to download the PDB-style file with coordinates for d1ep1b1.
(The format of our PDB-style files is described here.)

Timeline for d1ep1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ep1b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ep1a_