SCOPe 2.08: Domain d4cnib2: 4cni B:107-214

Lineage for d4cnib2 (4cni B:107-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4cnib2: 4cni B:107-214 [256636]
   Other proteins in same PDB: d4cnia_, d4cnib1, d4cnic_, d4cnid_, d4cnih_, d4cnil1
   automated match to d1dn0a2
   complexed with so4, tam

Details for d4cnib2

PDB Entry: 4cni, 2.2 Å

PDB Description: crystal structure of the fab portion of olokizumab in complex with il- 6

PDB Compounds: (B:) olokizumab light chain, fab portion

SCOPe Domain Sequences for d4cnib2:

Sequence; same for both SEQRES and ATOM records:

>d4cnib2 b.1.1.2 (B:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d4cnib2:

• d4cnib2 first appeared in SCOPe 2.04
  
• d4cnib2 appears in SCOPe 2.07