Lineage for d4cjga_ (4cjg A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699500Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2699788Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
    automatically mapped to Pfam PF01322
  6. 2699789Protein Cytochrome c' [47180] (9 species)
  7. 2699792Species Alcaligenes sp. [TaxId:512] [47184] (13 PDB entries)
  8. 2699796Domain d4cjga_: 4cjg A: [256624]
    automated match to d1e83a_
    complexed with hec, no

Details for d4cjga_

PDB Entry: 4cjg (more details), 1.26 Å

PDB Description: spectroscopically validated structure of the 5 coordinate proximal no adduct of cytochrome c prime from alcaligenes xylosoxidans
PDB Compounds: (A:) cytochrome c'

SCOPe Domain Sequences for d4cjga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cjga_ a.24.3.2 (A:) Cytochrome c' {Alcaligenes sp. [TaxId: 512]}
efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dayrkk

SCOPe Domain Coordinates for d4cjga_:

Click to download the PDB-style file with coordinates for d4cjga_.
(The format of our PDB-style files is described here.)

Timeline for d4cjga_: