Lineage for d1ndh_1 (1ndh 3-125)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60076Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 60149Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 60166Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (7 proteins)
  6. 60167Protein cytochrome b5 reductase [50427] (1 species)
  7. 60168Species Pig (Sus scrofa), liver [TaxId:9823] [50428] (1 PDB entry)
  8. 60169Domain d1ndh_1: 1ndh 3-125 [25662]
    Other proteins in same PDB: d1ndh_2

Details for d1ndh_1

PDB Entry: 1ndh (more details), 2.1 Å

PDB Description: crystal structure of nadh-cytochrome b5 reductase from pig liver at 2.4 angstroms resolution

SCOP Domain Sequences for d1ndh_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndh_1 b.43.4.2 (3-125) cytochrome b5 reductase {Pig (Sus scrofa), liver}
paitlenpdikyplrlidkevvnhdtrrfrfalpspehilglpvgqhiylsaridgnlvi
rpytpvssdddkgfvdlvikvyfkdthpkfpaggkmsqylesmkigdtiefrgpngllvy
qgk

SCOP Domain Coordinates for d1ndh_1:

Click to download the PDB-style file with coordinates for d1ndh_1.
(The format of our PDB-style files is described here.)

Timeline for d1ndh_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ndh_2