Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [256591] (1 PDB entry) |
Domain d4cbua1: 4cbu A:4-147 [256592] Other proteins in same PDB: d4cbua2, d4cbug_ automated match to d2btfa1 complexed with atp, ca |
PDB Entry: 4cbu (more details), 1.3 Å
SCOPe Domain Sequences for d4cbua1:
Sequence, based on SEQRES records: (download)
>d4cbua1 c.55.1.0 (A:4-147) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} edvqalvvdngsgnvkagvagddaprsvfpsivgrpknpgimvgmeekdafvgdeaqtkr giltlkypiehgivtnwddmekiwhhtfynelraapeehpvllteaplnpkgnrermtqi mfesfnvpamyvaiqavlslyssg
>d4cbua1 c.55.1.0 (A:4-147) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} edvqalvvdngsgnvkagvagddaprsvfpsivgrpknpkdafvgdeaqtkrgiltlkyp iehgivtnwddmekiwhhtfynelraapeehpvllteaplnpkgnrermtqimfesfnvp amyvaiqavlslyssg
Timeline for d4cbua1: