Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily) unusual fold |
Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) automatically mapped to Pfam PF03717 |
Family d.175.1.0: automated matches [227232] (1 protein) not a true family |
Protein automated matches [226981] (9 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [256159] (3 PDB entries) |
Domain d4bl2b2: 4bl2 B:139-327 [256555] Other proteins in same PDB: d4bl2a1, d4bl2a3, d4bl2b1, d4bl2b3 automated match to d1vqqa2 complexed with cd, cl; mutant |
PDB Entry: 4bl2 (more details), 2.72 Å
SCOPe Domain Sequences for d4bl2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bl2b2 d.175.1.0 (B:139-327) automated matches {Staphylococcus aureus [TaxId: 1280]} dqsihienlkskrgkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgp inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk kdgkdiqlt
Timeline for d4bl2b2: