SCOP 1.55: Domain d1a8p_1: 1a8p 2-100

Lineage for d1a8p_1 (1a8p 2-100)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)

4. Superfamily b.43.1: Ferredoxin reductase-like, FAD-binding (N-terminal) domain [50413] (5 families)

5. Family b.43.1.1: Reductases [50414] (4 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) [50415] (7 species)

7. Species Azotobacter vinelandii [TaxId:354] [50422] (1 PDB entry)

8. Domain d1a8p_1: 1a8p 2-100 [25654]
   Other proteins in same PDB: d1a8p_2

Details for d1a8p_1

PDB Entry: 1a8p, 2 Å

PDB Description: ferredoxin reductase from azotobacter vinelandii

SCOP Domain Sequences for d1a8p_1:

Sequence; same for both SEQRES and ATOM records:

>d1a8p_1 b.43.1.1 (2-100) Ferredoxin reductase (flavodoxin reductase) {Azotobacter vinelandii}
snlnvervlsvhhwndtlfsfkttrnpslrfengqfvmiglevdgrplmraysiaspnye
ehleffsikvqngpltsrlqhlkegdelmvsrkptgtlv

Timeline for d1a8p_1:

• d1a8p_1 appears in SCOP 1.57
  
• d1a8p_1 appears in the current release, SCOPe 2.08, called d1a8pa1