SCOPe 2.07: Domain d1fdra1: 1fdr A:2-100

Lineage for d1fdra1 (1fdr A:2-100)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species)

7. Species Escherichia coli [TaxId:562] [50421] (1 PDB entry)

8. Domain d1fdra1: 1fdr A:2-100 [25653]
   Other proteins in same PDB: d1fdra2
   complexed with fad

Details for d1fdra1

PDB Entry: 1fdr, 1.7 Å

PDB Description: flavodoxin reductase from e. coli

PDB Compounds: (A:) flavodoxin reductase

SCOPe Domain Sequences for d1fdra1:

Sequence, based on SEQRES records:

>d1fdra1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Escherichia coli [TaxId: 562]}
adwvtgkvtkvqnwtdalfsltvhapvlpftagqftklgleidgervqraysyvnspdnp
dlefylvtvpdgklsprlaalkpgdevqvvseaagffvl

Sequence, based on observed residues (ATOM records):

>d1fdra1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Escherichia coli [TaxId: 562]}
adwvtgkvtkvqnwtdalfsltvhapvlpftagqftklgleirvqraysyvnspdnpdle
fylvtvpdgklsprlaalkpgdevqvvseaagffvl

Timeline for d1fdra1:

• d1fdra1 first appeared (with stable ids) in SCOP 1.55, called d1fdr_1
  
• d1fdra1 appears in SCOPe 2.06
  
• d1fdra1 appears in the current release, SCOPe 2.08