Lineage for d1ewyb1 (1ewy B:1-141)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2063096Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2063153Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 2063181Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species)
  7. Species Anabaena sp., pcc 7119 [TaxId:1167] [50420] (19 PDB entries)
  8. 2063202Domain d1ewyb1: 1ewy B:1-141 [25652]
    Other proteins in same PDB: d1ewya2, d1ewyb2, d1ewyc_
    complexed with fad, fes

Details for d1ewyb1

PDB Entry: 1ewy (more details), 2.38 Å

PDB Description: anabaena pcc7119 ferredoxin:ferredoxin-nadp+-reductase complex
PDB Compounds: (B:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d1ewyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewyb1 b.43.4.2 (B:1-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Anabaena sp., pcc 7119 [TaxId: 1167]}
tqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsi
giippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcsty
lthiepgsevkitgpvgkeml

SCOPe Domain Coordinates for d1ewyb1:

Click to download the PDB-style file with coordinates for d1ewyb1.
(The format of our PDB-style files is described here.)

Timeline for d1ewyb1: