Lineage for d1ewya1 (1ewy A:1-141)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111309Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 111386Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 111406Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (7 proteins)
  6. 111418Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)
  7. 111421Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [50420] (12 PDB entries)
  8. 111433Domain d1ewya1: 1ewy A:1-141 [25651]
    Other proteins in same PDB: d1ewya2, d1ewyb2, d1ewyc_

Details for d1ewya1

PDB Entry: 1ewy (more details), 2.38 Å

PDB Description: anabaena pcc7119 ferredoxin:ferredoxin-nadp+-reductase complex

SCOP Domain Sequences for d1ewya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewya1 b.43.4.2 (A:1-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Cyanobacterium (Anabaena sp.), pcc 7119}
tqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsi
giippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcsty
lthiepgsevkitgpvgkeml

SCOP Domain Coordinates for d1ewya1:

Click to download the PDB-style file with coordinates for d1ewya1.
(The format of our PDB-style files is described here.)

Timeline for d1ewya1: