| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) ![]() automatically mapped to Pfam PF02046 |
| Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins) |
| Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species) probably responsible for the dimerization of the mitochondrial cytochrome c oxidase |
| Species Cow (Bos taurus) [TaxId:9913] [81408] (51 PDB entries) |
| Domain d3wg7t_: 3wg7 T: [256503] Other proteins in same PDB: d3wg7a_, d3wg7b1, d3wg7b2, d3wg7c_, d3wg7d_, d3wg7e_, d3wg7f_, d3wg7h_, d3wg7i_, d3wg7j_, d3wg7k_, d3wg7l_, d3wg7m_, d3wg7n_, d3wg7o1, d3wg7o2, d3wg7p_, d3wg7q_, d3wg7r_, d3wg7s_, d3wg7u_, d3wg7v_, d3wg7w_, d3wg7x_, d3wg7y_, d3wg7z_ automated match to d1v54g_ complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, zn |
PDB Entry: 3wg7 (more details), 1.9 Å
SCOPe Domain Sequences for d3wg7t_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wg7t_ f.23.2.1 (T:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek
Timeline for d3wg7t_:
View in 3DDomains from other chains: (mouse over for more information) d3wg7a_, d3wg7b1, d3wg7b2, d3wg7c_, d3wg7d_, d3wg7e_, d3wg7f_, d3wg7g_, d3wg7h_, d3wg7i_, d3wg7j_, d3wg7k_, d3wg7l_, d3wg7m_, d3wg7n_, d3wg7o1, d3wg7o2, d3wg7p_, d3wg7q_, d3wg7r_, d3wg7s_, d3wg7u_, d3wg7v_, d3wg7w_, d3wg7x_, d3wg7y_, d3wg7z_ |