SCOPe 2.05: Domain d3wg7s_: 3wg7 S:

Lineage for d3wg7s_ (3wg7 S:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
   membrane-anchored rubredoxin-like domain
   automatically mapped to Pfam PF01215

6. Protein Cytochrome c oxidase Subunit F [57819] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57820] (26 PDB entries)

8. Domain d3wg7s_: 3wg7 S: [256502]
   Other proteins in same PDB: d3wg7a_, d3wg7b1, d3wg7b2, d3wg7c_, d3wg7d_, d3wg7e_, d3wg7g_, d3wg7h_, d3wg7i_, d3wg7j_, d3wg7k_, d3wg7l_, d3wg7m_, d3wg7n_, d3wg7o1, d3wg7o2, d3wg7p_, d3wg7q_, d3wg7r_, d3wg7t_, d3wg7u_, d3wg7v_, d3wg7w_, d3wg7x_, d3wg7y_, d3wg7z_
   automated match to d1v54f_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, zn

Details for d3wg7s_

PDB Entry: 3wg7, 1.9 Å

PDB Description: a 1.9 angstrom radiation damage free x-ray structure of large (420kda) protein by femtosecond crystallography

PDB Compounds: (S:) cytochrome c oxidase subunit 5b, mitochondrial

SCOPe Domain Sequences for d3wg7s_:

Sequence; same for both SEQRES and ATOM records:

>d3wg7s_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

Timeline for d3wg7s_:

• d3wg7s_ first appeared in SCOPe 2.04
  
• d3wg7s_ appears in SCOPe 2.06
  
• d3wg7s_ appears in the current release, SCOPe 2.08