Lineage for d3wg7r_ (3wg7 R:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727193Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) (S)
    automatically mapped to Pfam PF02284
  5. 2727194Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)
  6. 2727195Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 2727196Species Cow (Bos taurus) [TaxId:9913] [48482] (50 PDB entries)
  8. 2727261Domain d3wg7r_: 3wg7 R: [256501]
    Other proteins in same PDB: d3wg7a_, d3wg7b1, d3wg7b2, d3wg7c_, d3wg7d_, d3wg7f_, d3wg7g_, d3wg7h_, d3wg7i_, d3wg7j_, d3wg7k_, d3wg7l_, d3wg7m_, d3wg7n_, d3wg7o1, d3wg7o2, d3wg7p_, d3wg7q_, d3wg7s_, d3wg7t_, d3wg7u_, d3wg7v_, d3wg7w_, d3wg7x_, d3wg7y_, d3wg7z_
    automated match to d1v54e_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, zn

Details for d3wg7r_

PDB Entry: 3wg7 (more details), 1.9 Å

PDB Description: a 1.9 angstrom radiation damage free x-ray structure of large (420kda) protein by femtosecond crystallography
PDB Compounds: (R:) cytochrome c oxidase subunit 5a, mitochondrial

SCOPe Domain Sequences for d3wg7r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wg7r_ a.118.11.1 (R:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d3wg7r_:

Click to download the PDB-style file with coordinates for d3wg7r_.
(The format of our PDB-style files is described here.)

Timeline for d3wg7r_: