SCOPe 2.03: Domain d1qufa1: 1quf A:8-141

Lineage for d1qufa1 (1quf A:8-141)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species)

7. Species Anabaena sp., pcc 7119 [TaxId:1167] [50420] (24 PDB entries)

8. Domain d1qufa1: 1quf A:8-141 [25650]
   Other proteins in same PDB: d1qufa2
   complexed with fad, nap

Details for d1qufa1

PDB Entry: 1quf, 2.25 Å

PDB Description: x-ray structure of a complex nadp+-ferredoxin:nadp+ reductase from the cyanobacterium anabaena pcc 7119 at 2.25 angstroms

PDB Compounds: (A:) ferredoxin-nadp+ reductase

SCOPe Domain Sequences for d1qufa1:

Sequence; same for both SEQRES and ATOM records:

>d1qufa1 b.43.4.2 (A:8-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Anabaena sp., pcc 7119 [TaxId: 1167]}
advpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgv
dkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepg
sevkitgpvgkeml

Timeline for d1qufa1:

• d1qufa1 first appeared (with stable ids) in SCOP 1.55, called d1quf_1
  
• d1qufa1 appears in SCOPe 2.02
  
• d1qufa1 appears in SCOPe 2.04
  
• d1qufa1 appears in the current release, SCOPe 2.08