Lineage for d3wcxa_ (3wcx A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548549Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2548550Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2548661Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 2548662Protein automated matches [190734] (13 species)
    not a true protein
  7. 2548719Species Streptomyces griseocarneus [TaxId:51201] [256476] (1 PDB entry)
  8. 2548720Domain d3wcxa_: 3wcx A: [256477]
    automated match to d2ddrc_
    complexed with epe, sin

Details for d3wcxa_

PDB Entry: 3wcx (more details), 2 Å

PDB Description: Crystal Structure of Sphingomyelinase C from Streptomyces griseocarneus
PDB Compounds: (A:) sphingomyelinase c

SCOPe Domain Sequences for d3wcxa_:

Sequence, based on SEQRES records: (download)

>d3wcxa_ d.151.1.0 (A:) automated matches {Streptomyces griseocarneus [TaxId: 51201]}
tpslkvltyntflmstglypnwgqehrareiaaagffqgndvvvlqeafdnaaadglkaa
aadrypyqtpvvgrsrdgwdatggkysattpedggvtvlskwpivrkeqvifndacgadw
wsnkgfayvvlnvggtrvhvvgthaqstdsgcaageaaadrsrqfrqidafldaknipad
eqvmlagdlnvdshsaeyasmladgdlapadsraghpysfdtkensiaayryptdpredl
dyvlhrngharpagwrntvvqetsapwtvsswgkrytytdlsghypviagan

Sequence, based on observed residues (ATOM records): (download)

>d3wcxa_ d.151.1.0 (A:) automated matches {Streptomyces griseocarneus [TaxId: 51201]}
tpslkvltyntflmstglypnwgqehrareiaaagffqgndvvvlqeafdnaaadglkaa
aadrypyqtpvvgrsrdgwdatggkysattpedggvtvlskwpivrkeqvifndacgadw
wsnkgfayvvlnvggtrvhvvgthaqstdsgcaageaaadrsrqfrqidafldaknipad
eqvmlagdlnvdshsaeyasmladgdlapadsraghpysfdtkensiaayryptdpredl
dyvlhrngharpagwrntvvqetsapwtvsswkrytytdlsghypviagan

SCOPe Domain Coordinates for d3wcxa_:

Click to download the PDB-style file with coordinates for d3wcxa_.
(The format of our PDB-style files is described here.)

Timeline for d3wcxa_: