Lineage for d3wcga_ (3wcg A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1504321Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 1504322Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 1504597Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 1504598Protein automated matches [196409] (27 species)
    not a true protein
  7. 1504703Species Trypanosoma cruzi [TaxId:353153] [256465] (3 PDB entries)
  8. 1504705Domain d3wcga_: 3wcg A: [256468]
    automated match to d3vjcb_
    complexed with bh3

Details for d3wcga_

PDB Entry: 3wcg (more details), 2.8 Å

PDB Description: The complex structure of TcSQS with ligand, BPH1344
PDB Compounds: (A:) Farnesyltransferase, putative

SCOPe Domain Sequences for d3wcga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wcga_ a.128.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
dedlrfcydilqavsrsfavvimeldeemrdavcifylvlraldtveddmsipvefklre
lpkfhehlhdttwcmsgvgvgrerellerythvtraysrlgkayqdvisgicermangmc
dfltrkvetkadydlychyvaglvghgltllyvssgledvrladdltnanhmglflqktn
iirdfyedicevpprvfwpreiwekytddlhafkdelheakaveclnamvadalvhvphv
veylaslrdpsvfafsaipqvmamatlslvfnnkdvfhtkvkttrgatarifhystelqa
tlqmlktytlrlaarmnaqdacydriehlvndairameshq

SCOPe Domain Coordinates for d3wcga_:

Click to download the PDB-style file with coordinates for d3wcga_.
(The format of our PDB-style files is described here.)

Timeline for d3wcga_: